- CEP27 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89895
- 0.1 ml (also 25ul)
- C15orf25, CEP27, HsT17025
- This antibody was developed against Recombinant Protein corresponding to amino acids: IPHLAANLKK MNQALAKMDI LVTETEELAE NILKWRKQQN EVSSCIPKIL AEESYLYKHD IIMPPLPFTS KVHVQTINAK
- Human
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- CEP27
- Rabbit
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- HAUS augmin like complex subunit 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cell Biology, Cell Cycle and Replication
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
IPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK
Specifications/Features
Available conjugates: Unconjugated